PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_08099-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 280aa    MW: 30521 Da    PI: 4.7591
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_08099-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.1e-165295146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg ++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++
  TRIUR3_08099-P1 52 RGCFSQQEEDHIVALHHILGNR-WSQIASHLP-GRTDNEIKNFWNS 95
                     899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.2271142IPR017877Myb-like domain
SMARTSM00717311548IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-42946IPR009057Homeodomain-like
SuperFamilySSF466891.55E-1932106IPR009057Homeodomain-like
PROSITE profilePS5129422.83647101IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-2447101IPR009057Homeodomain-like
SMARTSM007171.8E-135199IPR001005SANT/Myb domain
PfamPF002494.0E-145295IPR001005SANT/Myb domain
CDDcd001672.28E-105594No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRPLSGGVG QPKLRKGLWS PEEDETRLAG LNRCGKSCRL RWINYLRADL KRGCFSQQEE  60
DHIVALHHIL GNRWSQIASH LPGRTDNEIK NFWNSCIKKK LRQQGLDPAT HKPMAAAFTA  120
TAALPDAEEE DRKPLAAGAD GILAPKQPTV FHPFPVCADY GAGFADYLGA ANAAALYGQF  180
CGGNEGADED AGFGAADYSC VLDVSENLGY GESSRTSSNP NYGGEVGSML DGEVGSMLDG  240
EVLHWAKAEP AFAEMEYEFS LPCQEQSLLP NFEFNLEHYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-21101011108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0669460.0KM066946.1 Triticum aestivum R2R3-MYB transcription factor (MYB86) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961344.11e-103PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-148MYB3_HORVU; Myb-related protein Hv33
TrEMBLM7ZL770.0M7ZL77_TRIUA; Myb-related protein Hv33
STRINGSi022730m1e-103(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-52myb domain protein 86